PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v2900220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 305aa    MW: 35083.9 Da    PI: 7.1507
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v2900220.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-092352692155
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      k +yps+++++ LA+++gL+ +q+ +WF N+R ++
  Lj2g3v2900220.1 235 KWPYPSESQKQALAESTGLDLKQINNWFINQRKRH 269
                      569*****************************885 PP

2ELK38.52.5e-13189210122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK qLlrKYsgyLgsLk+EF+
  Lj2g3v2900220.1 189 ELKVQLLRKYSGYLGSLKKEFL 210
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.6E-1556100IPR005540KNOX1
PfamPF037906.3E-195899IPR005540KNOX1
SMARTSM012561.1E-24108159IPR005541KNOX2
PfamPF037914.9E-21112157IPR005541KNOX2
SMARTSM011887.1E-7189210IPR005539ELK domain
PROSITE profilePS5121311.139189209IPR005539ELK domain
PfamPF037891.9E-9189210IPR005539ELK domain
PROSITE profilePS5007112.228209272IPR001356Homeobox domain
SMARTSM003892.8E-12211276IPR001356Homeobox domain
SuperFamilySSF466891.92E-19211283IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28214275IPR009057Homeodomain-like
CDDcd000862.47E-12221273No hitNo description
PfamPF059202.6E-17229268IPR008422Homeobox KN domain
PROSITE patternPS000270247270IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MDMMNMETNR KFLSLPLSNN SNNNSGPQMR RVPVVMSNAQ DHNYSSQQQQ DHNTSSSVRD  60
KIMAHPLFPR LLSSYLNCLK VGAPPEVVAS LEESCAKCES LNASGRTGGG SLGEDPALDQ  120
FMEAYCEMLI KYEHELTKPF KEAMLFFSRI ECQLKALAVS TEFGQSESSS QNEVDVHENN  180
LDTQADDREL KVQLLRKYSG YLGSLKKEFL KKKKNGKLPK EARQQLLDWW NRHYKWPYPS  240
ESQKQALAES TGLDLKQINN WFINQRKRHW KPSEDMQFAV MDATNYYMEN VMCKPFPMDA  300
MPMLL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.56780.0flower
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1477950.0BT147795.1 Lotus japonicus clone JCVI-FLLj-16B16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141628.10.0hypothetical protein PHAVU_008G212100g
RefseqXP_014502682.10.0PREDICTED: homeobox protein SBH1-like isoform X2
RefseqXP_014502681.10.0PREDICTED: homeobox protein SBH1-like isoform X1
SwissprotP466081e-117HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLV7B6U20.0V7B6U2_PHAVU; Uncharacterized protein
STRINGGLYMA14G05150.21e-174(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-105KNOX/ELK homeobox transcription factor